General Information

  • ID:  hor005273
  • Uniprot ID:  P09682
  • Protein name:  Glucagon
  • Gene name:  gcg
  • Organism:  Hydrolagus colliei (Spotted ratfish) (Chimaera colliei)
  • Family:  Glucagon family
  • Source:  animal
  • Expression:  Produced by the X-cells of the islets of pancreas.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Hydrolagus (genus), Chimaeridae (family), Chimaeriformes (order), Holocephali (subclass), Chondrichthyes (class), Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007165 signal transduction; GO:0050896 response to stimulus
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  HTDGIFSSDYSKYLDNRRTKDFVQWLLSTKRNGANT
  • Length:  36
  • Propeptide:  HTDGIFSSDYSKYLDNRRTKDFVQWLLSTKRNGANT
  • Signal peptide:  NA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Promotes hydrolysis of glycogen and lipids, and raises the blood sugar level.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P09682-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    AF-P09682-F1.pdbhor005273_AF2.pdbhor005273_ESM.pdb

Physical Information

Mass: 486010 Formula: C186H285N55O59
Absent amino acids: CEMP Common amino acids: DST
pI: 9.86 Basic residues: 7
Polar residues: 15 Hydrophobic residues: 9
Hydrophobicity: -108.89 Boman Index: -11487
Half-Life: 3.5 hour Half-Life Yeast: 10 min
Half-Life E.Coli: >10 hour Aliphatic Index 54.17
Instability Index: 3145.56 Extinction Coefficient cystines: 8480
Absorbance 280nm: 242.29

Literature

  • PubMed ID:  3311036
  • Title:  A glucagon-like peptide, structurally related to mammalian oxyntomodulin, from the pancreas of a holocephalan fish, Hydrolagus colliei.